LYZL6 antibody (N-Term)

Catalog No. ABIN634036

This Rabbit Polyclonal antibody specifically detects LYZL6 in WB. It exhibits reactivity toward Human.

Quick Overview for LYZL6 antibody (N-Term) (ABIN634036)

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYZL6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LYZL6 Antibody

Binding Specificity: N-Term

Specificity: LYZL6 antibody was raised against the N terminal of LYZL6

Purification: Affinity purified

Immunogen: LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYZL6 Blocking Peptide, (ABIN5614619), is also available for use as a blocking control in assays to test for specificity of this LYZL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYZL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYZL6

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Alternative Name: LYZL6

Background: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Molecular Weight: 16 kDa (MW of target protein)