CPQ antibody (N-Term)

Catalog No. ABIN634040

The Rabbit Polyclonal anti-CPQ antibody has been validated for WB. It is suitable to detect CPQ in samples from Human, Mouse and Rat.

Quick Overview for CPQ antibody (N-Term) (ABIN634040)

Target: CPQ (Carboxypeptidase Q (CPQ))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPQ antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CPQ Antibody

Binding Specificity: N-Term

Specificity: PGCP antibody was raised against the N terminal of PGCP

Purification: Affinity purified

Immunogen: PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGCP Blocking Peptide, (ABIN5615332), is also available for use as a blocking control in assays to test for specificity of this PGCP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGCP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPQ

Target: CPQ (Carboxypeptidase Q (CPQ))

Alternative Name: PGCP

Background: PGCP is a carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.

Molecular Weight: 52 kDa (MW of target protein)