CES5A antibody (N-Term)

Catalog No. ABIN634041

This anti-CES5A antibody is a Rabbit Polyclonal antibody detecting CES5A in WB. Suitable for Human.

Quick Overview for CES5A antibody (N-Term) (ABIN634041)

Target: CES5A (Carboxylesterase 5A (CES5A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CES5A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CES5A Antibody

Binding Specificity: N-Term

Specificity: Carboxylesterase 7 antibody was raised against the N terminal of CES7

Purification: Affinity purified

Immunogen: Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxylesterase 7 Blocking Peptide, (ABIN5612613), is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CES5A

Target: CES5A (Carboxylesterase 5A (CES5A))

Alternative Name: Carboxylesterase 7

Background: CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Molecular Weight: 58 kDa (MW of target protein)