CES5A antibody (Middle Region)
-
- Target See all CES5A Antibodies
- CES5A (Carboxylesterase 5A (CES5A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CES5A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carboxylesterase 7 antibody was raised against the middle region of CES7
- Purification
- Affinity purified
- Immunogen
- Carboxylesterase 7 antibody was raised using the middle region of CES7 corresponding to a region with amino acids LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF
- Top Product
- Discover our top product CES5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carboxylesterase 7 Blocking Peptide, catalog no. 33R-5471, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CES5A (Carboxylesterase 5A (CES5A))
- Alternative Name
- Carboxylesterase 7 (CES5A Products)
- Background
- CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
- Molecular Weight
- 58 kDa (MW of target protein)
-