BMPER antibody (C-Term)

Catalog No. ABIN634046

The Rabbit Polyclonal anti-BMPER antibody has been validated for WB. It is suitable to detect BMPER in samples from Human, Mouse and Rat.

Quick Overview for BMPER antibody (C-Term) (ABIN634046)

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMPER antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BMPER Antibody

Binding Specificity: C-Term

Specificity: BMPER antibody was raised against the C terminal of BMPER

Purification: Affinity purified

Immunogen: BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BMPER Blocking Peptide, (ABIN5612349), is also available for use as a blocking control in assays to test for specificity of this BMPER antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMPER antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BMPER

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Alternative Name: BMPER

Background: BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

Molecular Weight: 76 kDa (MW of target protein)