RANGAP1 antibody (N-Term)

Catalog No. ABIN634052

The Rabbit Polyclonal anti-RANGAP1 antibody has been validated for WB. It is suitable to detect RANGAP1 in samples from Human, Mouse and Rat.

Quick Overview for RANGAP1 antibody (N-Term) (ABIN634052)

Target: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RANGAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RANGAP1 Antibody

Binding Specificity: N-Term

Specificity: RanGAP1 antibody was raised against the N terminal of RANGAP1

Purification: Affinity purified

Immunogen: RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RanGAP1 Blocking Peptide, (ABIN5615754), is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANGAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RANGAP1

Target: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Alternative Name: RanGAP1

Background: RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus