CHAF1B antibody
-
- Target See all CHAF1B Antibodies
- CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHAF1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHAF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
- Top Product
- Discover our top product CHAF1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHAF1B Blocking Peptide, catalog no. 33R-4709, is also available for use as a blocking control in assays to test for specificity of this CHAF1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))
- Alternative Name
- CHAF1B (CHAF1B Products)
- Background
- Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.
- Molecular Weight
- 61 kDa (MW of target protein)
-