STAG3 antibody (Middle Region)
-
- Target See all STAG3 Antibodies
- STAG3 (Stromal Antigen 3 (STAG3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STAG3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STAG3 antibody was raised against the middle region of STAG3
- Purification
- Affinity purified
- Immunogen
- STAG3 antibody was raised using the middle region of STAG3 corresponding to a region with amino acids VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS
- Top Product
- Discover our top product STAG3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STAG3 Blocking Peptide, catalog no. 33R-9729, is also available for use as a blocking control in assays to test for specificity of this STAG3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAG3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STAG3 (Stromal Antigen 3 (STAG3))
- Alternative Name
- STAG3 (STAG3 Products)
- Background
- STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
- Molecular Weight
- 135 kDa (MW of target protein)
-