STAG3 antibody (Middle Region)

Catalog No. ABIN634086

This anti-STAG3 antibody is a Rabbit Polyclonal antibody detecting STAG3 in WB. Suitable for Human.

Quick Overview for STAG3 antibody (Middle Region) (ABIN634086)

Target: STAG3 (Stromal Antigen 3 (STAG3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAG3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STAG3 Antibody

Binding Specificity: Middle Region

Specificity: STAG3 antibody was raised against the middle region of STAG3

Purification: Affinity purified

Immunogen: STAG3 antibody was raised using the middle region of STAG3 corresponding to a region with amino acids VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STAG3 Blocking Peptide, (ABIN5616410), is also available for use as a blocking control in assays to test for specificity of this STAG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STAG3

Target: STAG3 (Stromal Antigen 3 (STAG3))

Alternative Name: STAG3

Background: STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.

Molecular Weight: 135 kDa (MW of target protein)