NCAPH antibody (N-Term)

Catalog No. ABIN634092

This anti-NCAPH antibody is a Rabbit Polyclonal antibody detecting NCAPH in WB. Suitable for Human, Rat and Mouse.

Quick Overview for NCAPH antibody (N-Term) (ABIN634092)

Target: NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCAPH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NCAPH Antibody

Binding Specificity: N-Term

Specificity: NCAPH antibody was raised against the N terminal of NCAPH

Purification: Affinity purified

Immunogen: NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCAPH Blocking Peptide, (ABIN5614924), is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCAPH

Target: NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Alternative Name: NCAPH

Background: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Molecular Weight: 82 kDa (MW of target protein)