KIF22 antibody (N-Term)

Catalog No. ABIN634122

This anti-KIF22 antibody is a Rabbit Polyclonal antibody detecting KIF22 in WB. Suitable for Human.

Quick Overview for KIF22 antibody (N-Term) (ABIN634122)

Target: KIF22 (Kinesin Family Member 22 (KIF22))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF22 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KIF22 Antibody

Binding Specificity: N-Term

Specificity: KIF22 antibody was raised against the N terminal of KIF22

Purification: Affinity purified

Immunogen: KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF22 Blocking Peptide, (ABIN937195), is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF22

Target: KIF22 (Kinesin Family Member 22 (KIF22))

Alternative Name: KIF22

Background: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Molecular Weight: 73 kDa (MW of target protein)