Septin 11 antibody (N-Term)

Catalog No. ABIN634141

This Rabbit Polyclonal antibody specifically detects Septin 11 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Septin 11 antibody (N-Term) (ABIN634141)

Target: Septin 11 (SEPT11)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Septin 11 Antibody

Binding Specificity: N-Term

Specificity: Septin 11 antibody was raised against the N terminal of 40432

Purification: Affinity purified

Immunogen: Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Septin 11 Blocking Peptide, (ABIN5616049), is also available for use as a blocking control in assays to test for specificity of this Septin 11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40787 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 11

Target: Septin 11 (SEPT11)

Alternative Name: Septin 11

Background: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Molecular Weight: 49 kDa (MW of target protein)