UBE2C antibody (N-Term)

Catalog No. ABIN634160

The Rabbit Polyclonal anti-UBE2C antibody has been validated for WB. It is suitable to detect UBE2C in samples from Human, Mouse and Rat.

Quick Overview for UBE2C antibody (N-Term) (ABIN634160)

Target: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2C Antibody

Binding Specificity: N-Term

Specificity: UBE2 C antibody was raised against the N terminal of UBE2

Purification: Affinity purified

Immunogen: UBE2 C antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2C Blocking Peptide, (ABIN937948), is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2C

Target: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Alternative Name: UBE2C

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway