UBE2C antibody (N-Term)
-
- Target See all UBE2C Antibodies
- UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UBE2 C antibody was raised against the N terminal of UBE2
- Purification
- Affinity purified
- Immunogen
- UBE2 C antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS
- Top Product
- Discover our top product UBE2C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2C Blocking Peptide, catalog no. 33R-2562, is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))
- Alternative Name
- UBE2C (UBE2C Products)
- Background
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-