SET/TAF-I antibody (N-Term)

Catalog No. ABIN634191

Product Details anti-SET/TAF-I Antibody

Target: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SET/TAF-I antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SET antibody was raised against the N terminal of SET

Purification: Affinity purified

Immunogen: SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SET Blocking Peptide, catalog no. 33R-3911, is also available for use as a blocking control in assays to test for specificity of this SET antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SET antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SET/TAF-I

Target: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Alternative Name: SET (SET Products)

Synonyms: 2PP2A antibody, I2PP2A antibody, IGAAD antibody, IPP2A2 antibody, PHAPII antibody, TAF-I antibody, TAF-IBETA antibody, 2610030F17Rik antibody, 5730420M11Rik antibody, AA407739 antibody, I-2PP2A antibody, StF-IT-1 antibody, 2pp2a antibody, i2pp2a antibody, igaad antibody, ipp2a2 antibody, phapii antibody, set antibody, set-a antibody, set-b antibody, taf-ibeta antibody, wu:fb30g11 antibody, wu:fd16c08 antibody, SET nuclear proto-oncogene antibody, SET nuclear oncogene antibody, SET translocation antibody, SET nuclear proto-oncogene L homeolog antibody, SET nuclear proto-oncogene b antibody, SET antibody, Set antibody, LOC403555 antibody, set.L antibody, setb antibody

Background: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Apoptosis