RAD9B antibody

Catalog No. ABIN634195

This Rabbit Polyclonal antibody specifically detects RAD9B in WB. It exhibits reactivity toward Human.

Quick Overview for RAD9B antibody (ABIN634195)

Target: RAD9B (RAD9 Homolog B (RAD9B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD9B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAD9B Antibody

Purification: Affinity purified

Immunogen: RAD9 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD9B Blocking Peptide, (ABIN5615738), is also available for use as a blocking control in assays to test for specificity of this RAD9B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD9B

Target: RAD9B (RAD9 Homolog B (RAD9B))

Alternative Name: RAD9B

Background: The function of RAD9B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 28 kDa (MW of target protein)