MOS antibody (Middle Region)

Catalog No. ABIN634201

This Rabbit Polyclonal antibody specifically detects MOS in WB. It exhibits reactivity toward Human.

Quick Overview for MOS antibody (Middle Region) (ABIN634201)

Target: MOS (Moloney Sarcoma Oncogene (MOS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MOS Antibody

Binding Specificity: Middle Region

Specificity: MOS antibody was raised against the middle region of MOS

Purification: Affinity purified

Immunogen: MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOS Blocking Peptide, (ABIN5614814), is also available for use as a blocking control in assays to test for specificity of this MOS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOS

Target: MOS (Moloney Sarcoma Oncogene (MOS))

Alternative Name: MOS

Background: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.

Molecular Weight: 38 kDa (MW of target protein)