CCNYL1 antibody (N-Term)

Catalog No. ABIN634208

The Rabbit Polyclonal anti-CCNYL1 antibody has been validated for WB. It is suitable to detect CCNYL1 in samples from Human, Mouse and Rat.

Quick Overview for CCNYL1 antibody (N-Term) (ABIN634208)

Target: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCNYL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCNYL1 Antibody

Binding Specificity: N-Term

Specificity: Cyclin Y-Like 1 antibody was raised against the N terminal of CCNYL1

Purification: Affinity purified

Immunogen: Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin Y-Like 1 Blocking Peptide, (ABIN5613065), is also available for use as a blocking control in assays to test for specificity of this Cyclin Y-Like 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNYL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCNYL1

Target: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Alternative Name: Cyclin Y-Like 1

Background: The specific function of CCNYL1 is not yet known.

Molecular Weight: 33 kDa (MW of target protein)