ANAPC7 antibody (C-Term)

Catalog No. ABIN634214

The Rabbit Polyclonal anti-ANAPC7 antibody is suitable to detect ANAPC7 in samples from Human, Mouse and Dog. It has been validated for WB and IHC.

Quick Overview for ANAPC7 antibody (C-Term) (ABIN634214)

Target: ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANAPC7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ANAPC7 Antibody

Binding Specificity: C-Term

Specificity: ANAPC7 antibody was raised against the C terminal of ANAPC7

Purification: Affinity purified

Immunogen: ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANAPC7 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ANAPC7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANAPC7

Target: ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))

Alternative Name: ANAPC7

Background: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).

Molecular Weight: 62 kDa (MW of target protein)