ANAPC7 antibody (C-Term)
-
- Target See all ANAPC7 Antibodies
- ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANAPC7 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ANAPC7 antibody was raised against the C terminal of ANAPC7
- Purification
- Affinity purified
- Immunogen
- ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANAPC7 Blocking Peptide, catalog no. 33R-1371, is also available for use as a blocking control in assays to test for specificity of this ANAPC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))
- Alternative Name
- ANAPC7 (ANAPC7 Products)
- Background
- The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).
- Molecular Weight
- 62 kDa (MW of target protein)
-