Interleukin enhancer-binding factor 3 (ILF3) (N-Term) antibody

Catalog No. ABIN634215

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB and IHC. Suitable for Human.

Quick Overview for Interleukin enhancer-binding factor 3 (ILF3) (N-Term) antibody (ABIN634215)

Target: Interleukin enhancer-binding factor 3 (ILF3)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details

Binding Specificity: N-Term

Specificity: ILF3 antibody was raised against the N terminal of ILF3

Purification: Affinity purified

Immunogen: ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Application Details

Application Notes: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ILF3 Blocking Peptide, (ABIN5614181), is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Interleukin enhancer-binding factor 3 (ILF3)

Alternative Name: ILF3

Background: ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: M Phase