EIF4G2 antibody (N-Term)

Catalog No. ABIN634222

This Rabbit Polyclonal antibody specifically detects EIF4G2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for EIF4G2 antibody (N-Term) (ABIN634222)

Target: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4G2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF4G2 Antibody

Binding Specificity: N-Term

Specificity: EIF4 G2 antibody was raised against the N terminal of EIF4 2

Purification: Affinity purified

Immunogen: EIF4 G2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4G2 Blocking Peptide, (ABIN5613347), is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4G2

Target: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Alternative Name: EIF4G2

Background: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.

Molecular Weight: 102 kDa (MW of target protein)