PCBP4 antibody

Catalog No. ABIN634227

Product Details anti-PCBP4 Antibody

Target: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCBP4 Blocking Peptide, catalog no. 33R-7763, is also available for use as a blocking control in assays to test for specificity of this PCBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCBP4

Target: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Alternative Name: PCBP4 (PCBP4 Products)

Synonyms: Pcbp4 antibody, zgc:77347 antibody, wu:fc68f03 antibody, PCBP4 antibody, CBP antibody, LIP4 antibody, MCG10 antibody, 1200003L19Rik antibody, AlphaCP-4 antibody, poly(rC) binding protein 4 antibody, pcbp4 antibody, PCBP4 antibody, Pcbp4 antibody

Background: PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.

Molecular Weight: 47 kDa (MW of target protein)