PCBP4 antibody
-
- Target See all PCBP4 Antibodies
- PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCBP4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCBP4 Blocking Peptide, catalog no. 33R-7763, is also available for use as a blocking control in assays to test for specificity of this PCBP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))
- Alternative Name
- PCBP4 (PCBP4 Products)
- Synonyms
- Pcbp4 antibody, zgc:77347 antibody, wu:fc68f03 antibody, PCBP4 antibody, CBP antibody, LIP4 antibody, MCG10 antibody, 1200003L19Rik antibody, AlphaCP-4 antibody, poly(rC) binding protein 4 antibody, pcbp4 antibody, PCBP4 antibody, Pcbp4 antibody
- Background
- PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.
- Molecular Weight
- 47 kDa (MW of target protein)