NDN antibody

Catalog No. ABIN634231

Product Details anti-NDN Antibody

Target: NDN (Necdin Homolog (Mouse) (NDN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDN antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDN

Target: NDN (Necdin Homolog (Mouse) (NDN))

Alternative Name: NDN (NDN Products)

Synonyms: LOC574323 antibody, AI528698 antibody, Peg6 antibody, NDN antibody, HsT16328 antibody, PWCR antibody, necdin, MAGE family member antibody, necdin antibody, NDN antibody, Ndn antibody

Background: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway