KHDRBS1 antibody (N-Term)

Catalog No. ABIN634247

The Rabbit Polyclonal anti-KHDRBS1 antibody has been validated for WB. It is suitable to detect KHDRBS1 in samples from Human.

Quick Overview for KHDRBS1 antibody (N-Term) (ABIN634247)

Target: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHDRBS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KHDRBS1 Antibody

Binding Specificity: N-Term

Specificity: KHDRBS1 antibody was raised against the N terminal of KHDRBS1

Purification: Affinity purified

Immunogen: KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHDRBS1 Blocking Peptide, (ABIN5614315), is also available for use as a blocking control in assays to test for specificity of this KHDRBS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHDRBS1

Target: KHDRBS1 (KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1))

Alternative Name: KHDRBS1

Background: KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Neurotrophin Signaling Pathway, Autophagy