Factor II antibody

Catalog No. ABIN634253

The Rabbit Polyclonal anti- antibody has been validated for WB. It is suitable to detect in samples from Human, Mouse and Rat.

Quick Overview for Factor II antibody (ABIN634253)

Target: Factor II

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details

Purification: Affinity purified

Immunogen: Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Factor II Blocking Peptide, (ABIN939531), is also available for use as a blocking control in assays to test for specificity of this Factor II antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Factor II

Background: Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia.

Molecular Weight: 65 kDa (MW of target protein)