Factor II antibody
Reactivity: Human, Mouse, Rat
WB
Host: Rabbit
Polyclonal
unconjugated
-
- Target
- Factor II
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Factor II Blocking Peptide, catalog no. 33R-4145, is also available for use as a blocking control in assays to test for specificity of this Factor II antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Factor II
- Background
- Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia.
- Molecular Weight
- 65 kDa (MW of target protein)
-
You are here:
