ALOX15B antibody (Middle Region)
-
- Target See all ALOX15B Antibodies
- ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALOX15B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALOX15 B antibody was raised against the middle region of ALOX15
- Purification
- Affinity purified
- Immunogen
- ALOX15 B antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI
- Top Product
- Discover our top product ALOX15B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALOX15B Blocking Peptide, catalog no. 33R-1715, is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))
- Alternative Name
- ALOX15B (ALOX15B Products)
- Background
- ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.
- Molecular Weight
- 72 kDa (MW of target protein)
-