Inhibin alpha antibody (N-Term)

Catalog No. ABIN634265

Product Details anti-Inhibin alpha Antibody

Target: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Inhibin alpha antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Inhibin Alpha antibody was raised against the N terminal of INHA

Purification: Affinity purified

Immunogen: Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Inhibin Alpha Blocking Peptide, catalog no. 33R-3384, is also available for use as a blocking control in assays to test for specificity of this Inhibin Alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Inhibin alpha

Target: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Alternative Name: Inhibin alpha (INHA Products)

Synonyms: si:dkey-91f15.2 antibody, INHA antibody, MGC108500 antibody, AW555078 antibody, inhibin, alpha antibody, inhibin alpha subunit antibody, inhibin alpha antibody, inhibin alpha L homeolog antibody, inha antibody, INHA antibody, inha.L antibody, Inha antibody

Background: INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion