DUSP8 antibody (Middle Region)

Catalog No. ABIN634286

The Rabbit Polyclonal anti-DUSP8 antibody has been validated for WB. It is suitable to detect DUSP8 in samples from Human, Mouse and Rat.

Quick Overview for DUSP8 antibody (Middle Region) (ABIN634286)

Target: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUSP8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DUSP8 Antibody

Binding Specificity: Middle Region

Specificity: DUSP8 antibody was raised against the middle region of DUSP8

Purification: Affinity purified

Immunogen: DUSP8 antibody was raised using the middle region of DUSP8 corresponding to a region with amino acids PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DUSP8 Blocking Peptide, (ABIN5613271), is also available for use as a blocking control in assays to test for specificity of this DUSP8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DUSP8

Target: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Alternative Name: DUSP8

Background: DUSP8 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.

Molecular Weight: 66 kDa (MW of target protein)