ARL5A antibody (Middle Region)

Catalog No. ABIN634288

This Rabbit Polyclonal antibody specifically detects ARL5A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ARL5A antibody (Middle Region) (ABIN634288)

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL5A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARL5A Antibody

Binding Specificity: Middle Region

Specificity: ARL5 A antibody was raised against the middle region of ARL5

Purification: Affinity purified

Immunogen: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL5A Blocking Peptide, (ABIN936120), is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL5A

Target: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Alternative Name: ARL5A

Background: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Molecular Weight: 20 kDa (MW of target protein)