S100A9 antibody (N-Term)

Catalog No. ABIN634289

The Rabbit Polyclonal anti-S100A9 antibody has been validated for WB. It is suitable to detect S100A9 in samples from Human.

Quick Overview for S100A9 antibody (N-Term) (ABIN634289)

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S100A9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-S100A9 Antibody

Binding Specificity: N-Term

Specificity: S100 A9 antibody was raised against the N terminal of S100 9

Purification: Affinity purified

Immunogen: S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S100A9

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Alternative Name: S100A9

Background: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteins