RALGPS1 antibody (Middle Region)

Catalog No. ABIN634297

Product Details anti-RALGPS1 Antibody

Target: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALGPS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RALGPS1 antibody was raised against the middle region of RALGPS1

Purification: Affinity purified

Immunogen: RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALGPS1 Blocking Peptide, catalog no. 33R-1222, is also available for use as a blocking control in assays to test for specificity of this RALGPS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALGPS1

Target: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Alternative Name: RALGPS1 (RALGPS1 Products)

Synonyms: RALGEF2 antibody, RALGPS1A antibody, si:dkey-191c17.1 antibody, zgc:165535 antibody, 5830418G11Rik antibody, AI853783 antibody, AI854138 antibody, RalGEF 2 antibody, mKIAA0351 antibody, Ral GEF with PH domain and SH3 binding motif 1 antibody, RALGPS1 antibody, ralgps1 antibody, Ralgps1 antibody

Background: RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.

Molecular Weight: 62 kDa (MW of target protein)