RALGPS1 antibody (Middle Region)

Catalog No. ABIN634297

This Rabbit Polyclonal antibody specifically detects RALGPS1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for RALGPS1 antibody (Middle Region) (ABIN634297)

Target: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALGPS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RALGPS1 Antibody

Binding Specificity: Middle Region

Specificity: RALGPS1 antibody was raised against the middle region of RALGPS1

Purification: Affinity purified

Immunogen: RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALGPS1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RALGPS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALGPS1

Target: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Alternative Name: RALGPS1

Background: RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.

Molecular Weight: 62 kDa (MW of target protein)