B-Cell Linker antibody (Middle Region)
-
- Target See all B-Cell Linker (BLNK) Antibodies
- B-Cell Linker (BLNK)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B-Cell Linker antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BLNK antibody was raised against the middle region of BLNK
- Purification
- Affinity purified
- Immunogen
- BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
- Top Product
- Discover our top product BLNK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BLNK Blocking Peptide, catalog no. 33R-7788, is also available for use as a blocking control in assays to test for specificity of this BLNK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLNK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B-Cell Linker (BLNK)
- Alternative Name
- BLNK (BLNK Products)
- Background
- This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- BCR Signaling
-