Galectin 9 antibody

Catalog No. ABIN634316

Product Details anti-Galectin 9 Antibody

Target: Galectin 9 (LGALS9) (Lectin, Galactoside-Binding, Soluble, 9 (LGALS9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Galectin 9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS9 Blocking Peptide, catalog no. 33R-10199, is also available for use as a blocking control in assays to test for specificity of this LGALS9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Galectin 9

Target: Galectin 9 (LGALS9) (Lectin, Galactoside-Binding, Soluble, 9 (LGALS9))

Alternative Name: LGALS9 (LGALS9 Products)

Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H+RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.

Molecular Weight: 39 kDa (MW of target protein)