SNX5 antibody (N-Term)

Catalog No. ABIN634321

This Rabbit Polyclonal antibody specifically detects SNX5 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for SNX5 antibody (N-Term) (ABIN634321)

Target: SNX5 (Sorting Nexin 5 (SNX5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNX5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SNX5 Antibody

Binding Specificity: N-Term

Specificity: SNX5 antibody was raised against the N terminal of SNX5

Purification: Affinity purified

Immunogen: SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNX5 Blocking Peptide, (ABIN938512), is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNX5

Target: SNX5 (Sorting Nexin 5 (SNX5))

Alternative Name: SNX5

Background: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.

Molecular Weight: 47 kDa (MW of target protein)