FTH1 antibody (Middle Region)

Catalog No. ABIN634336

This Rabbit Polyclonal antibody specifically detects FTH1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for FTH1 antibody (Middle Region) (ABIN634336)

Target: FTH1 (Ferritin, Heavy Polypeptide 1 (FTH1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FTH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FTH1 Antibody

Binding Specificity: Middle Region

Specificity: FTH1 antibody was raised against the middle region of FTH1

Purification: Affinity purified

Immunogen: FTH1 antibody was raised using the middle region of FTH1 corresponding to a region with amino acids NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTH1 Blocking Peptide, (ABIN5613648), is also available for use as a blocking control in assays to test for specificity of this FTH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FTH1

Target: FTH1 (Ferritin, Heavy Polypeptide 1 (FTH1))

Alternative Name: FTH1

Background: FTH1 is the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis