SNX18 antibody (N-Term)

Catalog No. ABIN634337

The Rabbit Polyclonal anti-SNX18 antibody has been validated for WB. It is suitable to detect SNX18 in samples from Human.

Quick Overview for SNX18 antibody (N-Term) (ABIN634337)

Target: SNX18 (Sorting Nexin 18 (SNX18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNX18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SNX18 Antibody

Binding Specificity: N-Term

Specificity: SNAG1 antibody was raised against the N terminal Of Snag1

Purification: Affinity purified

Immunogen: SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNAG1 Blocking Peptide, (ABIN5616312), is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNX18

Target: SNX18 (Sorting Nexin 18 (SNX18))

Alternative Name: SNAG1

Background: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.

Molecular Weight: 69 kDa (MW of target protein)