STK38 antibody (C-Term)

Catalog No. ABIN634342

This Rabbit Polyclonal antibody specifically detects STK38 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for STK38 antibody (C-Term) (ABIN634342)

Target: STK38 (serine/threonine Kinase 38 (STK38))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STK38 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STK38 Antibody

Binding Specificity: C-Term

Specificity: STK38 antibody was raised against the C terminal of STK38

Purification: Affinity purified

Immunogen: STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK38 Blocking Peptide, (ABIN939352), is also available for use as a blocking control in assays to test for specificity of this STK38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STK38

Target: STK38 (serine/threonine Kinase 38 (STK38))

Alternative Name: STK38

Background: STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.

Molecular Weight: 54 kDa (MW of target protein)