NEK6 antibody

Catalog No. ABIN634350

The Rabbit Polyclonal anti-NEK6 antibody (ABIN634350) specifically detects NEK6 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for NEK6 antibody (ABIN634350)

Target: NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEK6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NEK6 Antibody

Purification: Affinity purified

Immunogen: NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEK6 Blocking Peptide, (ABIN938427), is also available for use as a blocking control in assays to test for specificity of this NEK6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEK6

Target: NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))

Alternative Name: NEK6

Background: The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.

Molecular Weight: 36 kDa (MW of target protein)