DVL2 antibody

Catalog No. ABIN634352

The Rabbit Polyclonal anti-DVL2 antibody has been validated for WB. It is suitable to detect DVL2 in samples from Human and Mouse.

Quick Overview for DVL2 antibody (ABIN634352)

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DVL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DVL2 Antibody

Purification: Affinity purified

Immunogen: DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DVL2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DVL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DVL2

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Alternative Name: DVL2

Background: DVL2 is a member of the dishevelled (dsh) protein family. It is a 90 kDa protein that undergoes posttranslational phosphorylation to form a 95 kDa cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Molecular Weight: 79 kDa (MW of target protein)

Pathways: Tube Formation