DVL2 antibody
-
- Target See all DVL2 Antibodies
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DVL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA
- Top Product
- Discover our top product DVL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DVL2 Blocking Peptide, catalog no. 33R-1228, is also available for use as a blocking control in assays to test for specificity of this DVL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
- Alternative Name
- DVL2 (DVL2 Products)
- Synonyms
- Xdsh antibody, dishevelled antibody, dsh antibody, dvl antibody, Dvl-2 antibody, xdsh antibody, wu:fc05d12 antibody, wu:fo71e09 antibody, wu:fp54a02 antibody, zgc:55372 antibody, dishevelled segment polarity protein 2 antibody, dishevelled segment polarity protein 2 L homeolog antibody, DVL2 antibody, dvl2 antibody, Dvl2 antibody, dvl2.L antibody
- Background
- DVL2 is a member of the dishevelled (dsh) protein family. It is a 90 kDa protein that undergoes posttranslational phosphorylation to form a 95 kDa cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
- Molecular Weight
- 79 kDa (MW of target protein)
- Pathways
- Tube Formation
-