MAP4K4 antibody (N-Term)

Catalog No. ABIN634358

The Rabbit Polyclonal anti-MAP4K4 antibody has been validated for WB. It is suitable to detect MAP4K4 in samples from Human, Mouse and Rat.

Quick Overview for MAP4K4 antibody (N-Term) (ABIN634358)

Target: MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP4K4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAP4K4 Antibody

Binding Specificity: N-Term

Specificity: MAP4 K4 antibody was raised against the N terminal of MAP4 4

Purification: Affinity purified

Immunogen: MAP4 K4 antibody was raised using the N terminal of MAP4 4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP4K4 Blocking Peptide, (ABIN5614656), is also available for use as a blocking control in assays to test for specificity of this MAP4K4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP4K4

Target: MAP4K4 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4))

Alternative Name: MAP4K4

Background: MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.

Molecular Weight: 133 kDa (MW of target protein)