RAB23 antibody (N-Term)

Catalog No. ABIN634360

Product Details anti-RAB23 Antibody

Target: RAB23 (RAB23, Member RAS Oncogene Family (RAB23))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB23 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB23 antibody was raised against the N terminal of RAB23

Purification: Affinity purified

Immunogen: RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB23 Blocking Peptide, catalog no. 33R-9136, is also available for use as a blocking control in assays to test for specificity of this RAB23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB23

Target: RAB23 (RAB23, Member RAS Oncogene Family (RAB23))

Alternative Name: RAB23 (RAB23 Products)

Background: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Tube Formation