GUCY1B3 antibody (N-Term)

Catalog No. ABIN634375

This Rabbit Polyclonal antibody specifically detects GUCY1B3 in WB. It exhibits reactivity toward Human, Mouse and Dog.

Quick Overview for GUCY1B3 antibody (N-Term) (ABIN634375)

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GUCY1B3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GUCY1B3 Antibody

Binding Specificity: N-Term

Specificity: GUCY1 B3 antibody was raised against the N terminal of GUCY1 3

Purification: Affinity purified

Immunogen: GUCY1 B3 antibody was raised using the N terminal of GUCY1 3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GUCY1B3 Blocking Peptide, (ABIN940427), is also available for use as a blocking control in assays to test for specificity of this GUCY1B3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCY0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GUCY1B3

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Alternative Name: GUCY1B3

Background: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis