CANT1 antibody (Middle Region)

Catalog No. ABIN634381

Product Details anti-CANT1 Antibody

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CANT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CANT1 antibody was raised against the middle region of CANT1

Purification: Affinity purified

Immunogen: CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CANT1 Blocking Peptide, catalog no. 33R-8666, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CANT1

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Alternative Name: CANT1 (CANT1 Products)

Synonyms: DBQD antibody, SCAN-1 antibody, SCAN1 antibody, SHAPY antibody, 5830420C20Rik antibody, Apy1h antibody, D11Bwg0554e antibody, Entpd8 antibody, Shapy antibody, srapy antibody, apyrase antibody, xapy antibody, cant1 antibody, entpd8 antibody, zgc:85724 antibody, CANT1 antibody, zgc:101021 antibody, calcium activated nucleotidase 1 antibody, calcium activated nucleotidase 1 L homeolog antibody, calcium activated nucleotidase 1a antibody, calcium activated nucleotidase 1b antibody, CANT1 antibody, Cant1 antibody, cant1.L antibody, cant1 antibody, cant1a antibody, LOAG_01305 antibody, cant1b antibody

Background: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

Molecular Weight: 45 kDa (MW of target protein)