GNA15 antibody (N-Term)

Catalog No. ABIN634382

The Rabbit Polyclonal anti-GNA15 antibody is suitable to detect GNA15 in samples from Human. It has been validated for WB.

Quick Overview for GNA15 antibody (N-Term) (ABIN634382)

Target: GNA15 (Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNA15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNA15 Antibody

Binding Specificity: N-Term

Specificity: GNA15 antibody was raised against the N terminal of GNA15

Purification: Affinity purified

Immunogen: GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNA15 Blocking Peptide, (ABIN936879), is also available for use as a blocking control in assays to test for specificity of this GNA15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNA15

Target: GNA15 (Guanine Nucleotide Binding Protein (G Protein), alpha 15 (Gq Class) (GNA15))

Alternative Name: GNA15

Background: GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Molecular Weight: 41 kDa (MW of target protein)