OTUD6B antibody (Middle Region)

Catalog No. ABIN634385

The Rabbit Polyclonal anti-OTUD6B antibody is suitable to detect OTUD6B in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for OTUD6B antibody (Middle Region) (ABIN634385)

Target: OTUD6B (OTU Domain Containing 6B (OTUD6B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTUD6B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OTUD6B Antibody

Binding Specificity: Middle Region

Specificity: OTUD6 B antibody was raised against the middle region of OTUD6

Purification: Affinity purified

Immunogen: OTUD6 B antibody was raised using the middle region of OTUD6 corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OTUD6B Blocking Peptide, (ABIN937859), is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OTUD6B

Target: OTUD6B (OTU Domain Containing 6B (OTUD6B))

Alternative Name: OTUD6B

Background: Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Molecular Weight: 37 kDa (MW of target protein)