DIRAS1 antibody (N-Term)

Catalog No. ABIN634394

The Rabbit Polyclonal anti-DIRAS1 antibody is suitable to detect DIRAS1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for DIRAS1 antibody (N-Term) (ABIN634394)

Target: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIRAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DIRAS1 Antibody

Binding Specificity: N-Term

Specificity: DIRAS1 antibody was raised against the N terminal of DIRAS1

Purification: Affinity purified

Immunogen: DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DIRAS1 Blocking Peptide, (ABIN5613205), is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIRAS1

Target: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Alternative Name: DIRAS1

Background: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly