ALOX15 antibody (Middle Region)
-
- Target See all ALOX15 Antibodies
- ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALOX15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALOX15 antibody was raised against the middle region of ALOX15
- Purification
- Affinity purified
- Immunogen
- ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
- Top Product
- Discover our top product ALOX15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALOX15 Blocking Peptide, catalog no. 33R-7578, is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))
- Alternative Name
- ALOX15 (ALOX15 Products)
- Background
- ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.
- Molecular Weight
- 73 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-