ALOX15 antibody (Middle Region)

Catalog No. ABIN634401

This anti-ALOX15 antibody is a Rabbit Polyclonal antibody detecting ALOX15 in WB. Suitable for Human.

Quick Overview for ALOX15 antibody (Middle Region) (ABIN634401)

Target: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALOX15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALOX15 Antibody

Binding Specificity: Middle Region

Specificity: ALOX15 antibody was raised against the middle region of ALOX15

Purification: Affinity purified

Immunogen: ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALOX15 Blocking Peptide, (ABIN5612029), is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALOX15

Target: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Alternative Name: ALOX15

Background: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization