ALOX15 antibody (Middle Region)

Catalog No. ABIN634401

Product Details anti-ALOX15 Antibody

Target: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALOX15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALOX15 antibody was raised against the middle region of ALOX15

Purification: Affinity purified

Immunogen: ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALOX15 Blocking Peptide, catalog no. 33R-7578, is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALOX15

Target: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Alternative Name: ALOX15 (ALOX15 Products)

Synonyms: 15-LOX-1 antibody, 15LOX-1 antibody, ALOX15 antibody, 12-LO antibody, Alox12l antibody, L-12LO antibody, 12-LOX antibody, Alox12 antibody, ALOX12 antibody, 15-LOX antibody, Alox12e antibody, arachidonate 15-lipoxygenase antibody, Arachidonate 15-lipoxygenase antibody, ALOX15 antibody, Alox15 antibody, Nmul_A0532 antibody, Sden_1680 antibody, Swoo_2919 antibody, PCC8801_3106 antibody, Cyan8802_3014 antibody, Nwat_1315 antibody

Background: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization