RAB39B antibody (N-Term)

Catalog No. ABIN634406

The Rabbit Polyclonal anti-RAB39B antibody has been validated for WB. It is suitable to detect RAB39B in samples from Human and Mouse.

Quick Overview for RAB39B antibody (N-Term) (ABIN634406)

Target: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB39B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB39B Antibody

Binding Specificity: N-Term

Specificity: RAB39 B antibody was raised against the N terminal of RAB39

Purification: Affinity purified

Immunogen: RAB39 B antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB39B Blocking Peptide, (ABIN5615709), is also available for use as a blocking control in assays to test for specificity of this RAB39B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB39B

Target: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Alternative Name: RAB39B

Background: RAB39B may be involved in vesicular trafficking.

Molecular Weight: 24 kDa (MW of target protein)